HNRPH1 antibody (70R-4663)

Rabbit polyclonal HNRPH1 antibody raised against the middle region of Hnrph1

Synonyms Polyclonal HNRPH1 antibody, Anti-HNRPH1 antibody, HNRPH antibody, HNRPH 1, DKFZp686A15170 antibody, Heterogeneous Nuclear Ribonucleoprotein H1 antibody, HNRPH-1, HNRPH 1 antibody, hnRNPH antibody, HNRPH-1 antibody, HNRPH1
Specificity HNRPH1 antibody was raised against the middle region of Hnrph1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
Assay Information HNRPH1 Blocking Peptide, catalog no. 33R-2975, is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody


Western blot analysis using HNRPH1 antibody (70R-4663)

Lanes : Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate. HNRPH1 antibody at 1:4000.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using HNRPH1 antibody (70R-4663) | Lanes : Lane 1: 20ug HeLa S3 lysate Lane 2: 20ug MCF7 lysate Lane 3: 20ug K562 lysate. HNRPH1 antibody at 1:4000.
  • Western blot analysis using HNRPH1 antibody (70R-4663) | MCF7 cells staied with HNRPH1 antibody at 1.0ug/ml
  • Western blot analysis using HNRPH1 antibody (70R-4663) | Recommended HNRPH1 Antibody Titration: 0.2-1 ug/ml
  • Western blot analysis using HNRPH1 antibody (70R-4663) | Jurkat cells stained with HNRPH1 antibody at 1.0ug/ml

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors