HNRPK antibody (70R-4651)

Rabbit polyclonal HNRPK antibody raised against the N terminal of HNRPK

Synonyms Polyclonal HNRPK antibody, Anti-HNRPK antibody, Heterogeneous Nuclear Ribonucleoprotein K antibody
Specificity HNRPK antibody was raised against the N terminal of HNRPK
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen HNRPK antibody was raised using the N terminal of HNRPK corresponding to a region with amino acids NTETNGEFGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKG
Assay Information HNRPK Blocking Peptide, catalog no. 33R-6896, is also available for use as a blocking control in assays to test for specificity of this HNRPK antibody


Immunohistochemical staining using HNRPK antibody (70R-4651)

HNRPK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.2-1 ug/ml; IHC: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPK belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). The hnRNP proteins have distinct nucleic acid binding properties. HNRPK is located in the nucleoplasm and has three repeats of KH domains that binds to RNAs. It is distinct among other hnRNP proteins in its binding preference; it binds tenaciously to poly(C). This protein is also thought to have a role during cell cycle progession. Multiple alternatively spliced transcript variants have been described for this gene but only three variants have been fully described.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPK antibody (70R-4651) | HNRPK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using HNRPK antibody (70R-4651) | Western Blot showing HNRPK antibody used at a concentration of 1-2 ug/ml to detect its target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors