HNRPL antibody (70R-4681)

Rabbit polyclonal HNRPL antibody raised against the N terminal of HNRPL

Synonyms Polyclonal HNRPL antibody, Anti-HNRPL antibody, Heterogeneous Nuclear Ribonucleoprotein L antibody
Specificity HNRPL antibody was raised against the N terminal of HNRPL
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Assay Information HNRPL Blocking Peptide, catalog no. 33R-1021, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody


Immunohistochemical staining using HNRPL antibody (70R-4681)

HNRPL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HNRPL antibody (70R-4681) | HNRPL antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using HNRPL antibody (70R-4681) | HNRPL antibody (70R-4681) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors