ACADM Blocking Peptide (33R-1020)

A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPL antibody, catalog no. 70R-4681

Synonyms HNRPL control peptide, HNRPL antibody Blocking Peptide, Anti-HNRPL Blocking Peptide, Heterogeneous Nuclear Ribonucleoprotein L Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
Molecular Weight 65 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €113.70
Size: 100 ug
OR
Shipping
View Our Distributors