ACADM Blocking Peptide (33R-1020)
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPL antibody, catalog no. 70R-4681
Overview
Overview
| Synonyms | HNRPL control peptide, HNRPL antibody Blocking Peptide, Anti-HNRPL Blocking Peptide, Heterogeneous Nuclear Ribonucleoprotein L Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV |
|---|---|
| Molecular Weight | 65 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product