HNRPLL Blocking Peptide (33R-8037)
A synthetic peptide for use as a blocking control in assays to test for specificity of HNRPLL antibody, catalog no. 70R-1458
Overview
Overview
| Synonyms | HNRPLL control peptide, HNRPLL antibody Blocking Peptide, Anti-HNRPLL Blocking Peptide, Heterogeneous Nuclear Ribonucleoprotein L-Like Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVS |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HNRPLL contains 3 RRM (RNA recognition motif) domains and may bind RNA and plays a role in mRNA processing. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product