HNRPUL1 antibody (70R-4684)

Rabbit polyclonal HNRPUL1 antibody raised against the middle region of Hnrpul1

Synonyms Polyclonal HNRPUL1 antibody, Anti-HNRPUL1 antibody, Heterogeneous Nuclear Ribonucleoprotein U-Like 1 antibody, FLJ12944 antibody, HNRPUL-1 antibody, HNRPUL 1 antibody, E1BAP5 antibody, HNRPUL-1, E1B-AP5 antibody, HNRPUL1, HNRPUL 1
Specificity HNRPUL1 antibody was raised against the middle region of Hnrpul1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG
Assay Information HNRPUL1 Blocking Peptide, catalog no. 33R-5262, is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody


Western Blot analysis using HNRPUL1 antibody (70R-4684)

HNRPUL1 antibody (70R-4684) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 85 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPUL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HNRPUL1 antibody (70R-4684) | HNRPUL1 antibody (70R-4684) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors