HOMER1 antibody (70R-4096)

Rabbit polyclonal HOMER1 antibody

Synonyms Polyclonal HOMER1 antibody, Anti-HOMER1 antibody, HOMER1, HOMER 1, Homer Homolog 1 antibody, Ves-1 antibody, HOMER1C antibody, HOMER1A antibody, SYN47 antibody, HOMER-1, HOMER-1 antibody, HOMER1B antibody, HOMER 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD
Assay Information HOMER1 Blocking Peptide, catalog no. 33R-2502, is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody


Western Blot analysis using HOMER1 antibody (70R-4096)

HOMER1 antibody (70R-4096) used at 0.0156 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HOMER1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.0156 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HOMER1 antibody (70R-4096) | HOMER1 antibody (70R-4096) used at 0.0156 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors