HP1BP3 antibody (70R-3142)

Rabbit polyclonal HP1BP3 antibody raised against the middle region of HP1BP3

Synonyms Polyclonal HP1BP3 antibody, Anti-HP1BP3 antibody, RP5-930J4.3 antibody, MGC43701 antibody, HPBP3 1, HP1-BP74 antibody, HPBP3-1, HPBP3-1 antibody, Heterochromatin Protein 1 Binding Protein 3 antibody, HP1BP3, HPBP3 1 antibody
Specificity HP1BP3 antibody was raised against the middle region of HP1BP3
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen HP1BP3 antibody was raised using the middle region of HP1BP3 corresponding to a region with amino acids QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL
Assay Information HP1BP3 Blocking Peptide, catalog no. 33R-7796, is also available for use as a blocking control in assays to test for specificity of this HP1BP3 antibody


Western Blot analysis using HP1BP3 antibody (70R-3142)

HP1BP3 antibody (70R-3142) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HP1BP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HP1BP3 antibody (70R-3142) | HP1BP3 antibody (70R-3142) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors