HP1BP3 Blocking Peptide (33R-7796)
A synthetic peptide for use as a blocking control in assays to test for specificity of HP1BP3 antibody, catalog no. 70R-3142
Overview
Overview
| Synonyms | HP1BP3 control peptide, HP1BP3 antibody Blocking Peptide, Anti-HP1BP3 Blocking Peptide, Heterochromatin Protein 1 Binding Protein 3 Blocking Peptide, HP1-BP74 Blocking Peptide, MGC43701 Blocking Peptide, RP5-930J4.3 Blocking Peptide, HP1BP3, HPBP3-1, HPBP3 1, HPBP3-1 Blocking Peptide, HPBP3 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL |
|---|---|
| Molecular Weight | 61 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product