HP1BP3 Blocking Peptide (33R-7796)

A synthetic peptide for use as a blocking control in assays to test for specificity of HP1BP3 antibody, catalog no. 70R-3142

Synonyms HP1BP3 control peptide, HP1BP3 antibody Blocking Peptide, Anti-HP1BP3 Blocking Peptide, Heterochromatin Protein 1 Binding Protein 3 Blocking Peptide, HP1-BP74 Blocking Peptide, MGC43701 Blocking Peptide, RP5-930J4.3 Blocking Peptide, HP1BP3, HPBP3-1, HPBP3 1, HPBP3-1 Blocking Peptide, HPBP3 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QYYPKLRVDIRPQLLKNALQRAVERGQLEQITGKGASGTFQLKKSGEKPL
Molecular Weight 61 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors