HPGD Blocking Peptide (33R-10315)

A synthetic peptide for use as a blocking control in assays to test for specificity of HPGD antibody, catalog no. 70R-10224

Synonyms HPGD control peptide, HPGD antibody Blocking Peptide, Anti-HPGD Blocking Peptide, hydroxyprostaglandin dehydrogenase 15-(NAD Blocking Peptide, 15-PGDH Blocking Peptide, PGDH Blocking Peptide, PGDH1 Blocking Peptide, SDR36C1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues DQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTY
Molecular Weight 29 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors