HPRT1 antibody (70R-2022)

Rabbit polyclonal HPRT1 antibody

Synonyms Polyclonal HPRT1 antibody, Anti-HPRT1 antibody, HPRT antibody, Lesch-Nyhan Syndrome antibody, HGPRT antibody, Hypoxanthine Phosphoribosyltransferase 1 antibody
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK
Assay Information HPRT1 Blocking Peptide, catalog no. 33R-8866, is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody


Western Blot analysis using HPRT1 antibody (70R-2022)

HPRT1 antibody (70R-2022) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HPRT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HPRT1 antibody (70R-2022) | HPRT1 antibody (70R-2022) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors