HS1BP3 Blocking Peptide (33R-10239)

A synthetic peptide for use as a blocking control in assays to test for specificity of HS1BP3 antibody, catalog no. 70R-4018

Synonyms HS1BP3 control peptide, HS1BP3 antibody Blocking Peptide, Anti-HS1BP3 Blocking Peptide, Hcls1 Binding Protein 3 Blocking Peptide, ETM2 Blocking Peptide, FLJ14249 Blocking Peptide, HS1-BP3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS
Molecular Weight 43 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors