HS1BP3 Blocking Peptide (33R-10239)
A synthetic peptide for use as a blocking control in assays to test for specificity of HS1BP3 antibody, catalog no. 70R-4018
Overview
Overview
| Synonyms | HS1BP3 control peptide, HS1BP3 antibody Blocking Peptide, Anti-HS1BP3 Blocking Peptide, Hcls1 Binding Protein 3 Blocking Peptide, ETM2 Blocking Peptide, FLJ14249 Blocking Peptide, HS1-BP3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS |
|---|---|
| Molecular Weight | 43 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product