HSD11B1 Blocking Peptide (33R-7614)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSD11B1 antibody, catalog no. 70R-7468

Synonyms HSD11B1 control peptide, HSD11B1 antibody Blocking Peptide, Anti-HSD11B1 Blocking Peptide, Hydroxysteroid 11B1 Blocking Peptide, 11-Beta Dehydrogenase 1 Blocking Peptide, 11-DH Blocking Peptide, 11-beta-HSD1 Blocking Peptide, HDL Blocking Peptide, HSD11 Blocking Peptide, HSD11B Blocking Peptide, HSD11L Blocking Peptide, MGC13539 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors