HSD11B1 Blocking Peptide (33R-7614)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSD11B1 antibody, catalog no. 70R-7468
Overview
Overview
| Synonyms | HSD11B1 control peptide, HSD11B1 antibody Blocking Peptide, Anti-HSD11B1 Blocking Peptide, Hydroxysteroid 11B1 Blocking Peptide, 11-Beta Dehydrogenase 1 Blocking Peptide, 11-DH Blocking Peptide, 11-beta-HSD1 Blocking Peptide, HDL Blocking Peptide, HSD11 Blocking Peptide, HSD11B Blocking Peptide, HSD11L Blocking Peptide, MGC13539 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHI |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HSD11B1 is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, HSD11B1 can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product