HSD17B1 antibody (70R-3201)

Rabbit polyclonal HSD17B1 antibody

Synonyms Polyclonal HSD17B1 antibody, Anti-HSD17B1 antibody, EDHB17 antibody, 17-Beta Dehydrogenase 1 antibody, HSD17 antibody, EDH17B2 antibody, Hydroxysteroid 17B1 antibody
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen HSD17B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA
Assay Information HSD17B1 Blocking Peptide, catalog no. 33R-5737, is also available for use as a blocking control in assays to test for specificity of this HSD17B1 antibody

Images

Immunohistochemical staining using HSD17B1 antibody (70R-3201)

HSD17B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSD17B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSD17B1 is favors the reduction of estrogens and androgens. It also has 20-alpha-HSD activity. It uses preferentially NADH.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using HSD17B1 antibody (70R-3201) | HSD17B1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using HSD17B1 antibody (70R-3201) | HSD17B1 antibody (70R-3201) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors