HSD17B14 Blocking Peptide (33R-7670)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSD17B14 antibody, catalog no. 70R-3811

Synonyms HSD17B14 control peptide, HSD17B14 antibody Blocking Peptide, Anti-HSD17B14 Blocking Peptide, Hydroxysteroid 17B14 Blocking Peptide, 17-Beta Dehydrogenase 14 Blocking Peptide, DHRS10 Blocking Peptide, retSDR3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP
Molecular Weight 28 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors