HSD17B14 Blocking Peptide (33R-7670)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSD17B14 antibody, catalog no. 70R-3811
Overview
Overview
| Synonyms | HSD17B14 control peptide, HSD17B14 antibody Blocking Peptide, Anti-HSD17B14 Blocking Peptide, Hydroxysteroid 17B14 Blocking Peptide, 17-Beta Dehydrogenase 14 Blocking Peptide, DHRS10 Blocking Peptide, retSDR3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP |
|---|---|
| Molecular Weight | 28 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | 17-beta-hydroxysteroid dehydrogenases, such as HSD17B14, are primarily involved in metabolism of steroids at the C17 position and also of other substrates, such as fatty acids, prostaglandins, and xenobiotics. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product