HSD17B6 antibody (70R-1258)

Rabbit polyclonal HSD17B6 antibody raised against the N terminal of HSD17B6

Synonyms Polyclonal HSD17B6 antibody, Anti-HSD17B6 antibody, HSE antibody, 17-Beta Dehydrogenase 6 Homolog antibody, Hydroxysteroid 17B6 antibody, RODH antibody
Specificity HSD17B6 antibody was raised against the N terminal of HSD17B6
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen HSD17B6 antibody was raised using the N terminal of HSD17B6 corresponding to a region with amino acids MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLD
Assay Information HSD17B6 Blocking Peptide, catalog no. 33R-6617, is also available for use as a blocking control in assays to test for specificity of this HSD17B6 antibody


Immunohistochemical staining using HSD17B6 antibody (70R-1258)

HSD17B6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hemopoietic cells (arrows) in Human Liver. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HSD17B6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSD17B6 has both oxidoreductase and epimerase activities and is involved in androgen catabolism. The oxidoreductase activity can convert 3 alpha-adiol to dihydrotestosterone, while the epimerase activity can convert androsterone to epi-androsterone. Both reactions use NAD+ as the preferred cofactor. HSD17B6 is a member of the retinol dehydrogenase family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using HSD17B6 antibody (70R-1258) | HSD17B6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hemopoietic cells (arrows) in Human Liver. Magnification is at 400X
  • Western Blot analysis using HSD17B6 antibody (70R-1258) | HSD17B6 antibody (70R-1258) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors