HSD3B2 Blocking Peptide (33R-3671)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSD3B2 antibody, catalog no. 70R-6441
Overview
Overview
| Synonyms | HSD3B2 control peptide, HSD3B2 antibody Blocking Peptide, Anti-HSD3B2 Blocking Peptide, Hydroxy-Delta-5-Steroid Dehydrogenase 3 Beta- And Steroid Delta-Isomerase 2 Blocking Peptide, HSDB Blocking Peptide, HSDB3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product