HSD3B2 Blocking Peptide (33R-3671)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSD3B2 antibody, catalog no. 70R-6441

Synonyms HSD3B2 control peptide, HSD3B2 antibody Blocking Peptide, Anti-HSD3B2 Blocking Peptide, Hydroxy-Delta-5-Steroid Dehydrogenase 3 Beta- And Steroid Delta-Isomerase 2 Blocking Peptide, HSDB Blocking Peptide, HSDB3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors