HSPA4 Blocking Peptide (33R-6956)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA4 antibody, catalog no. 70R-3047

Synonyms HSPA4 control peptide, HSPA4 antibody Blocking Peptide, Anti-HSPA4 Blocking Peptide, Heat Shock 70Kda Protein 4 Blocking Peptide, APG-2 Blocking Peptide, HS24/P52 Blocking Peptide, MGC131852 Blocking Peptide, RY Blocking Peptide, hsp70 Blocking Peptide, hsp70RY Blocking Peptide, HSP70 Blocking Peptide, HSP70, HSP-70, HSP 70, HSP-70 Blocking Peptide, HSP 70 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS
Molecular Weight 94 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors