HSPA4 Blocking Peptide (33R-6956)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPA4 antibody, catalog no. 70R-3047
Overview
Overview
| Synonyms | HSPA4 control peptide, HSPA4 antibody Blocking Peptide, Anti-HSPA4 Blocking Peptide, Heat Shock 70Kda Protein 4 Blocking Peptide, APG-2 Blocking Peptide, HS24/P52 Blocking Peptide, MGC131852 Blocking Peptide, RY Blocking Peptide, hsp70 Blocking Peptide, hsp70RY Blocking Peptide, HSP70 Blocking Peptide, HSP70, HSP-70, HSP 70, HSP-70 Blocking Peptide, HSP 70 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAFSDPFVEAEKS |
|---|---|
| Molecular Weight | 94 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product