HSPA4L antibody (70R-3945)

Rabbit polyclonal HSPA4L antibody raised against the C terminal of HSPA4L

Synonyms Polyclonal HSPA4L antibody, Anti-HSPA4L antibody, HSP-70, HSP70 antibody, HSP 70 antibody, HSP-70 antibody, HSP 70, APG-1 antibody, Osp94 antibody, HSP70, Heat Shock 70Kda Protein 4-Like antibody, HSP70-4 antibody
Specificity HSPA4L antibody was raised against the C terminal of HSPA4L
Cross Reactivity Human
Applications WB
Immunogen HSPA4L antibody was raised using the C terminal of HSPA4L corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
Assay Information HSPA4L Blocking Peptide, catalog no. 33R-4284, is also available for use as a blocking control in assays to test for specificity of this HSPA4L antibody


Western Blot analysis using HSPA4L antibody (70R-3945)

HSPA4L antibody (70R-3945) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPA4L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSPA4L antibody (70R-3945) | HSPA4L antibody (70R-3945) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors