HSPB1 Blocking Peptide (33R-8623)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB1 antibody, catalog no. 20R-1061
Overview
Overview
| Synonyms | HSPB1 control peptide, HSPB1 antibody Blocking Peptide, Anti-HSPB1 Blocking Peptide, heat shock 27kDa protein 1 Blocking Peptide, CMT2F Blocking Peptide, DKFZp586P1322 Blocking Peptide, HS.76067 Blocking Peptide, HSP27 Blocking Peptide, HSP28 Blocking Peptide, Hsp25 Blocking Peptide, HSPB1, HSPB-1, HSPB 1, HSPB-1 Blocking Peptide, HSPB 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HSPB1, like the other heat shock proteins, is part of a complex system of molecular chaperones in epidermal keratinocytes. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product