HSPB1 Blocking Peptide (33R-8623)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPB1 antibody, catalog no. 20R-1061

Synonyms HSPB1 control peptide, HSPB1 antibody Blocking Peptide, Anti-HSPB1 Blocking Peptide, heat shock 27kDa protein 1 Blocking Peptide, CMT2F Blocking Peptide, DKFZp586P1322 Blocking Peptide, HS.76067 Blocking Peptide, HSP27 Blocking Peptide, HSP28 Blocking Peptide, Hsp25 Blocking Peptide, HSPB1, HSPB-1, HSPB 1, HSPB-1 Blocking Peptide, HSPB 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPB1, like the other heat shock proteins, is part of a complex system of molecular chaperones in epidermal keratinocytes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors