HSPB6 antibody (70R-1292)

Rabbit polyclonal HSPB6 antibody raised against the middle region of HSPB6

Synonyms Polyclonal HSPB6 antibody, Anti-HSPB6 antibody, HSPB 6, FLJ32389 antibody, HSPB 6 antibody, Heat Shock Protein Alpha-Crystallin-Related B6 antibody, HSPB6, HSPB-6 antibody, HSPB-6, HSPB6 antibody, Hsp20 antibody
Specificity HSPB6 antibody was raised against the middle region of HSPB6
Cross Reactivity Human
Applications WB
Immunogen HSPB6 antibody was raised using the middle region of HSPB6 corresponding to a region with amino acids ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
Assay Information HSPB6 Blocking Peptide, catalog no. 33R-1474, is also available for use as a blocking control in assays to test for specificity of this HSPB6 antibody


Western Blot analysis using HSPB6 antibody (70R-1292)

HSPB6 antibody (70R-1292) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of HSPB6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin and modulates smooth muscle relaxation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSPB6 antibody (70R-1292) | HSPB6 antibody (70R-1292) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors