HSPBAP1 Blocking Peptide (33R-1024)
A synthetic peptide for use as a blocking control in assays to test for specificity of HSPBAP1 antibody, catalog no. 70R-8373
Overview
Overview
| Synonyms | HSPBAP1 control peptide, HSPBAP1 antibody Blocking Peptide, Anti-HSPBAP1 Blocking Peptide, HSPB, heat shock 27kDa associated protein 1 Blocking Peptide, FLJ22623 Blocking Peptide, FLJ39386 Blocking Peptide, PASS1 Blocking Peptide, HSPBAP1, HSPBAP-1, HSPBAP 1, HSPBAP-1 Blocking Peptide, HSPBAP 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF |
|---|---|
| Molecular Weight | 55 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | HSPBAP1 may play a role in cellular stress response. A chromosomal aberration involving HSPBAP1 is found in familial renal cell carcinoma 1 (RCC1). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product