HSPBAP1 Blocking Peptide (33R-1024)

A synthetic peptide for use as a blocking control in assays to test for specificity of HSPBAP1 antibody, catalog no. 70R-8373

Synonyms HSPBAP1 control peptide, HSPBAP1 antibody Blocking Peptide, Anti-HSPBAP1 Blocking Peptide, HSPB, heat shock 27kDa associated protein 1 Blocking Peptide, FLJ22623 Blocking Peptide, FLJ39386 Blocking Peptide, PASS1 Blocking Peptide, HSPBAP1, HSPBAP-1, HSPBAP 1, HSPBAP-1 Blocking Peptide, HSPBAP 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAGSEATTPVIVAAGAGGEEGEHVKPFKPEKAKEIIMSLQQPAIFCNMVF
Molecular Weight 55 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPBAP1 may play a role in cellular stress response. A chromosomal aberration involving HSPBAP1 is found in familial renal cell carcinoma 1 (RCC1).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors