HSPC111 antibody (70R-3260)

Rabbit polyclonal HSPC111 antibody raised against the middle region of HSPC111

Synonyms Polyclonal HSPC111 antibody, Anti-HSPC111 antibody, HSPC-111, HSPC111, HSPC 111 antibody, HSPC-111 antibody, HSPC 111, HSPC111, HSPC185 antibody, Hypothetical Protein Hspc111 antibody
Specificity HSPC111 antibody was raised against the middle region of HSPC111
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen HSPC111 antibody was raised using the middle region of HSPC111 corresponding to a region with amino acids RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR
Assay Information HSPC111 Blocking Peptide, catalog no. 33R-8012, is also available for use as a blocking control in assays to test for specificity of this HSPC111 antibody

Images

Western Blot analysis using HSPC111 antibody (70R-3260)

HSPC111 antibody (70R-3260) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPC111 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance NOP16 is transcriptionally regulated by c-Myc, upregulated in breast cancer, and overexpression is associated with poor patient survival.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using HSPC111 antibody (70R-3260) | HSPC111 antibody (70R-3260) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors