HSPE1 antibody (70R-4219)

Rabbit polyclonal HSPE1 antibody

Synonyms Polyclonal HSPE1 antibody, Anti-HSPE1 antibody, HSP 10, HSP-10 antibody, GROES antibody, Heat Shock 10Kda Protein 1 antibody, HSP 10 antibody, HSP10, HSP10 antibody, Chaperonin 10 antibody, HSP10 antibody, CPN10 antibody, HSP-10
Cross Reactivity Human,Mouse
Applications WB
Immunogen HSPE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
Assay Information HSPE1 Blocking Peptide, catalog no. 33R-3360, is also available for use as a blocking control in assays to test for specificity of this HSPE1 antibody


Western Blot analysis using HSPE1 antibody (70R-4219)

HSPE1 antibody (70R-4219) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 11 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HSPE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance HSPE1 is a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HSPE1 antibody (70R-4219) | HSPE1 antibody (70R-4219) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors