HYAL3 Blocking Peptide (33R-10389)

A synthetic peptide for use as a blocking control in assays to test for specificity of HYAL3 antibody, catalog no. 70R-10387

Synonyms HYAL3 control peptide, HYAL3 antibody Blocking Peptide, Anti-HYAL3 Blocking Peptide, hyaluronoglucosaminidase 3 Blocking Peptide, LUCA-3 Blocking Peptide, LUCA14 Blocking Peptide, LUCA3 Blocking Peptide, Minna14 Blocking Peptide, HYAL3, HYAL-3, HYAL 3, HYAL-3 Blocking Peptide, HYAL 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RAAMACSHQRCHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWG
Molecular Weight 46 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the hyaluronidase family. Hyaluronidases are endoglycosidase enzymes that degrade hyaluronan, one of the major glycosaminoglycans of the extracellular matrix. The regulated turnover of hyaluronan plays a critical role in many biological processes including cell proliferation, migration and differentiation. The encoded protein may also play an important role in sperm function. This gene is one of several related genes in a region of chromosome 3p21.3 associated with tumor suppression, and the expression of specific transcript variants may be indicative of tumor status.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors