HYLS1 antibody (70R-4391)

Rabbit polyclonal HYLS1 antibody raised against the middle region of HYLS1

Synonyms Polyclonal HYLS1 antibody, Anti-HYLS1 antibody, HLS antibody, FLJ32915 antibody, Hydrolethalus Syndrome 1 antibody
Specificity HYLS1 antibody was raised against the middle region of HYLS1
Cross Reactivity Human
Applications WB
Immunogen HYLS1 antibody was raised using the middle region of HYLS1 corresponding to a region with amino acids YFEYKRDWDSIRLPGEDHRKELRWGVREQMLCRAEPQSKPQHIYVPNNYL
Assay Information HYLS1 Blocking Peptide, catalog no. 33R-10093, is also available for use as a blocking control in assays to test for specificity of this HYLS1 antibody


Western Blot analysis using HYLS1 antibody (70R-4391)

HYLS1 antibody (70R-4391) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HYLS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This protein is a protein localized to the cytoplasm. Mutations in this protein are associated with hydrolethalus syndrome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using HYLS1 antibody (70R-4391) | HYLS1 antibody (70R-4391) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors