IARS antibody (70R-3173)

Rabbit polyclonal IARS antibody raised against the middle region of IARS

Synonyms Polyclonal IARS antibody, Anti-IARS antibody, PRO0785 antibody, IARS1 antibody, ILRS antibody, Isoleucyl-tRNA Synthetase antibody, FLJ20736 antibody
Specificity IARS antibody was raised against the middle region of IARS
Cross Reactivity Human
Applications WB
Immunogen IARS antibody was raised using the middle region of IARS corresponding to a region with amino acids YEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTAD
Assay Information IARS Blocking Peptide, catalog no. 33R-10078, is also available for use as a blocking control in assays to test for specificity of this IARS antibody

Western Blot analysis using IARS antibody (70R-3173)

IARS antibody (70R-3173) used at 1 ug/ml to detect target protein.

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 144 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using IARS antibody (70R-3173) | IARS antibody (70R-3173) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
View Our Distributors