ICA1L antibody (70R-4147)

Rabbit polyclonal ICA1L antibody raised against the middle region of ICA1L

Synonyms Polyclonal ICA1L antibody, Anti-ICA1L antibody, MGC138440 antibody, ICA1, ICA-1 antibody, ICA-1, ICA 1 antibody, ALS2CR14 antibody, ICA 1, DKFZp434E1919 antibody, Islet Cell Autoantigen 169Kda-Like antibody, ALS2CR15 antibody
Specificity ICA1L antibody was raised against the middle region of ICA1L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ICA1L antibody was raised using the middle region of ICA1L corresponding to a region with amino acids PVPSQSPKKLTRSPNNGNQDMSAWFNLFADLDPLSNPDAIGHSDDELLNA
Assay Information ICA1L Blocking Peptide, catalog no. 33R-7421, is also available for use as a blocking control in assays to test for specificity of this ICA1L antibody


Western Blot analysis using ICA1L antibody (70R-4147)

ICA1L antibody (70R-4147) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ICA1L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ICA1L contains 1 AH domain. The function of the ICA1L protein remains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ICA1L antibody (70R-4147) | ICA1L antibody (70R-4147) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors