ICT1 antibody (70R-2716)

Rabbit polyclonal ICT1 antibody raised against the middle region of ICT1

Synonyms Polyclonal ICT1 antibody, Anti-ICT1 antibody, DS-1 antibody, Immature Colon Carcinoma Transcript 1 antibody
Specificity ICT1 antibody was raised against the middle region of ICT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ICT1 antibody was raised using the middle region of ICT1 corresponding to a region with amino acids AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM
Assay Information ICT1 Blocking Peptide, catalog no. 33R-1157, is also available for use as a blocking control in assays to test for specificity of this ICT1 antibody

Images

Western Blot analysis using ICT1 antibody (70R-2716)

ICT1 antibody (70R-2716) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ICT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The adult colon epithelium contains 3 differentiated cell types that arise from a multipotent stem cell. Deviation from the normal maturation pathway by neoplastic transformation is thought to initiate in stem cells or their early descendants. One potential marker is ICT1 whose mRNA and protein were more highly expressed in undifferentiated than in differentiated cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ICT1 antibody (70R-2716) | ICT1 antibody (70R-2716) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors