IDH1 antibody (70R-2495)

Rabbit polyclonal IDH1 antibody

Synonyms Polyclonal IDH1 antibody, Anti-IDH1 antibody, IDH-1 antibody, IDH 1 antibody, Isocitrate Dehydrogenase 1 antibody, IDH antibody, PICD antibody, IDH 1, IDH1, Nadp+ Soluble antibody, IDP antibody, IDH-1
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen IDH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQ
Assay Information IDH1 Blocking Peptide, catalog no. 33R-9808, is also available for use as a blocking control in assays to test for specificity of this IDH1 antibody


Immunohistochemical staining using IDH1 antibody (70R-2495)

IDH1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IDH1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using IDH1 antibody (70R-2495) | IDH1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using IDH1 antibody (70R-2495) | IDH1 antibody (70R-2495) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using IDH1 antibody (70R-2495) | IDH1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors