IER5L Blocking Peptide (33R-8655)

A synthetic peptide for use as a blocking control in assays to test for specificity of IER5L antibody, catalog no. 70R-4284

Synonyms IER5L control peptide, IER5L antibody Blocking Peptide, Anti-IER5L Blocking Peptide, Immediate Early Response 5-Like Blocking Peptide, MGC70833 Blocking Peptide, bA247A12.2 Blocking Peptide, IER5, IER-5, IER 5, IER-5 Blocking Peptide, IER 5 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA
Molecular Weight 42 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of IER5 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors