IER5L Blocking Peptide (33R-8655)
A synthetic peptide for use as a blocking control in assays to test for specificity of IER5L antibody, catalog no. 70R-4284
Overview
Overview
| Synonyms | IER5L control peptide, IER5L antibody Blocking Peptide, Anti-IER5L Blocking Peptide, Immediate Early Response 5-Like Blocking Peptide, MGC70833 Blocking Peptide, bA247A12.2 Blocking Peptide, IER5, IER-5, IER 5, IER-5 Blocking Peptide, IER 5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA |
|---|---|
| Molecular Weight | 42 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of IER5 protein is not widely studied, and is yet to be elucidated fully. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product