IFIT3 antibody (70R-3590)

Rabbit polyclonal IFIT3 antibody raised against the N terminal of IFIT3

Synonyms Polyclonal IFIT3 antibody, Anti-IFIT3 antibody, ISG60 antibody, CIG-49 antibody, IFIT3, IRG2 antibody, IFIT 3, Interferon-Induced Protein With Tetratricopeptide Repeats 3 antibody, IFIT4 antibody, IFIT-3 antibody, GARG-49 antibody, IFIT 3 antibody, IFIT-3, IFI60 antibody, RIG-G antibody
Specificity IFIT3 antibody was raised against the N terminal of IFIT3
Cross Reactivity Human
Applications IHC, WB
Immunogen IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY
Assay Information IFIT3 Blocking Peptide, catalog no. 33R-1568, is also available for use as a blocking control in assays to test for specificity of this IFIT3 antibody


Immunohistochemical staining using IFIT3 antibody (70R-3590)

IFIT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFIT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFIT3 is involved in protein binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using IFIT3 antibody (70R-3590) | IFIT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using IFIT3 antibody (70R-3590) | IFIT3 antibody (70R-3590) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using IFIT3 antibody (70R-3590) | IFIT3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain EpitheliaI cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors