IFIT5 antibody (70R-5820)

Rabbit polyclonal IFIT5 antibody raised against the middle region of IFIT5

Synonyms Polyclonal IFIT5 antibody, Anti-IFIT5 antibody, IFIT 5, RI58 antibody, Interferon-Induced Protein With Tetratricopeptide Repeats 5 antibody, IFIT-5, IFIT 5 antibody, IFIT5, IFIT-5 antibody
Specificity IFIT5 antibody was raised against the middle region of IFIT5
Cross Reactivity Human
Applications WB
Immunogen IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE
Assay Information IFIT5 Blocking Peptide, catalog no. 33R-4192, is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody


Western Blot analysis using IFIT5 antibody (70R-5820)

IFIT5 antibody (70R-5820) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFIT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IFIT5 antibody (70R-5820) | IFIT5 antibody (70R-5820) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors