IFLTD1 antibody (70R-4170)

Rabbit polyclonal IFLTD1 antibody raised against the middle region of IFLTD1

Synonyms Polyclonal IFLTD1 antibody, Anti-IFLTD1 antibody, Pas1c1 antibody, FLJ36004 antibody, Intermediate Filament Tail Domain Containing 1 antibody
Specificity IFLTD1 antibody was raised against the middle region of IFLTD1
Cross Reactivity Human
Applications WB
Immunogen IFLTD1 antibody was raised using the middle region of IFLTD1 corresponding to a region with amino acids PPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPN
Assay Information IFLTD1 Blocking Peptide, catalog no. 33R-7284, is also available for use as a blocking control in assays to test for specificity of this IFLTD1 antibody


Western Blot analysis using IFLTD1 antibody (70R-4170)

IFLTD1 antibody (70R-4170) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFLTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of IFLTD protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IFLTD1 antibody (70R-4170) | IFLTD1 antibody (70R-4170) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors