IFN Alpha 5 Blocking Peptide (33R-9048)
A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA5 antibody, catalog no. 70R-5360
Overview
Overview
| Synonyms | IFN Alpha 5 control peptide, IFN Alpha 5 antibody Blocking Peptide, Anti-IFN Alpha 5 Blocking Peptide, Interferon Alpha 5 Blocking Peptide, INFA5 Blocking Peptide, IFNA5 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY |
|---|---|
| Molecular Weight | 20 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product