IFN Alpha 7 antibody (70R-5430)

Rabbit polyclonal IFN Alpha 7 antibody raised against the N terminal of IFNA7

Synonyms Polyclonal IFN Alpha 7 antibody, Anti-IFN Alpha 7 antibody, Interferon Alpha 7 antibody, IFNA7 antibody, IFNA-J antibody
Specificity IFN Alpha 7 antibody was raised against the N terminal of IFNA7
Cross Reactivity Human
Applications WB
Immunogen IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Assay Information IFN Alpha 7 Blocking Peptide, catalog no. 33R-7815, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody

Images

Western Blot analysis using IFN Alpha 7 antibody (70R-5430)

IFN Alpha 7 antibody (70R-5430) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFNA7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using IFN Alpha 7 antibody (70R-5430) | IFN Alpha 7 antibody (70R-5430) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors