IFN Alpha 7 Blocking Peptide (33R-7815)
A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA7 antibody, catalog no. 70R-5430
Overview
Overview
| Synonyms | IFN Alpha 7 control peptide, IFN Alpha 7 antibody Blocking Peptide, Anti-IFN Alpha 7 Blocking Peptide, Interferon Alpha 7 Blocking Peptide, IFNA-J Blocking Peptide, IFNA7 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ |
|---|---|
| Molecular Weight | 22 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product