IFN Alpha 7 Blocking Peptide (33R-7815)

A synthetic peptide for use as a blocking control in assays to test for specificity of IFNA7 antibody, catalog no. 70R-5430

Synonyms IFN Alpha 7 control peptide, IFN Alpha 7 antibody Blocking Peptide, Anti-IFN Alpha 7 Blocking Peptide, Interferon Alpha 7 Blocking Peptide, IFNA-J Blocking Peptide, IFNA7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ
Molecular Weight 22 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors