IFRD1 Blocking Peptide (33R-9754)
A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-1986
Overview
Overview
| Synonyms | IFRD1 control peptide, IFRD1 antibody Blocking Peptide, Anti-IFRD1 Blocking Peptide, Interferon-Related Developmental Regulator 1 Blocking Peptide, PC4 Blocking Peptide, TIS7 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL |
|---|---|
| Molecular Weight | 50 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product