IFRD1 Blocking Peptide (33R-9754)

A synthetic peptide for use as a blocking control in assays to test for specificity of IFRD1 antibody, catalog no. 70R-1986

Synonyms IFRD1 control peptide, IFRD1 antibody Blocking Peptide, Anti-IFRD1 Blocking Peptide, Interferon-Related Developmental Regulator 1 Blocking Peptide, PC4 Blocking Peptide, TIS7 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL
Molecular Weight 50 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors