IFT122 antibody (70R-2627)

Rabbit polyclonal IFT122 antibody

Synonyms Polyclonal IFT122 antibody, Anti-IFT122 antibody, WDR140 antibody, SPG antibody, WDR10 antibody, WDR10p antibody, Intraflagellar Transport 122 Homolog antibody
Cross Reactivity Human
Applications WB
Immunogen IFT122 antibody was raised using a synthetic peptide corresponding to a region with amino acids QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS
Assay Information IFT122 Blocking Peptide, catalog no. 33R-7457, is also available for use as a blocking control in assays to test for specificity of this IFT122 antibody


Western Blot analysis using IFT122 antibody (70R-2627)

IFT122 antibody (70R-2627) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 129 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IFT122 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IFT122 antibody (70R-2627) | IFT122 antibody (70R-2627) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors