IGFBP2 Blocking Peptide (33R-4590)
A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP2 antibody, catalog no. 70R-5304
Overview
Overview
| Synonyms | IGFBP2 control peptide, IGFBP2 antibody Blocking Peptide, Anti-IGFBP2 Blocking Peptide, Insulin-Like Growth Factor Binding Protein 2 36Kda Blocking Peptide, IBP2 Blocking Peptide, IGF-BP53 Blocking Peptide, IGFBP2, IGFBP-2, IGFBP 2, IGFBP-2 Blocking Peptide, IGFBP 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ |
|---|---|
| Molecular Weight | 35 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product