IGFBP2 Blocking Peptide (33R-4590)

A synthetic peptide for use as a blocking control in assays to test for specificity of IGFBP2 antibody, catalog no. 70R-5304

Synonyms IGFBP2 control peptide, IGFBP2 antibody Blocking Peptide, Anti-IGFBP2 Blocking Peptide, Insulin-Like Growth Factor Binding Protein 2 36Kda Blocking Peptide, IBP2 Blocking Peptide, IGF-BP53 Blocking Peptide, IGFBP2, IGFBP-2, IGFBP 2, IGFBP-2 Blocking Peptide, IGFBP 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ
Molecular Weight 35 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors