IGLL1 antibody (70R-1641)

Rabbit polyclonal IGLL1 antibody raised against the N terminal of IGLL1

Synonyms Polyclonal IGLL1 antibody, Anti-IGLL1 antibody, IGO antibody, IGLL antibody, VPREB2 antibody, CD179b antibody, IGL5 antibody, IGL1 antibody, 14.1 antibody, Immunoglobulin Lambda-Like Polypeptide 1 antibody, IGVPB antibody, IGLJ14.1 antibody
Specificity IGLL1 antibody was raised against the N terminal of IGLL1
Cross Reactivity Human
Applications WB
Immunogen IGLL1 antibody was raised using the N terminal of IGLL1 corresponding to a region with amino acids RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT
Assay Information IGLL1 Blocking Peptide, catalog no. 33R-8211, is also available for use as a blocking control in assays to test for specificity of this IGLL1 antibody


Western Blot analysis using IGLL1 antibody (70R-1641)

IGLL1 antibody (70R-1641) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IGLL1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin geneuperfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IGLL1 antibody (70R-1641) | IGLL1 antibody (70R-1641) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors