IGLL1 Blocking Peptide (33R-8211)
A synthetic peptide for use as a blocking control in assays to test for specificity of IGLL1 antibody, catalog no. 70R-1641
Overview
Overview
| Synonyms | IGLL1 control peptide, IGLL1 antibody Blocking Peptide, Anti-IGLL1 Blocking Peptide, Immunoglobulin Lambda-Like Polypeptide 1 Blocking Peptide, 14.1 Blocking Peptide, CD179b Blocking Peptide, IGL1 Blocking Peptide, IGL5 Blocking Peptide, IGLJ14.1 Blocking Peptide, IGLL Blocking Peptide, IGO Blocking Peptide, IGVPB Blocking Peptide, VPREB2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
|---|---|
| Molecular Weight | 19 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The preB cell receptor is found on the surface of proB and preB cells, where it is involved in transduction of signals for cellular proliferation, differentiation from the proB cell to the preB cell stage, allelic exclusion at the Ig heavy chain gene locus, and promotion of Ig light chain gene rearrangements. The preB cell receptor is composed of a membrane-bound Ig mu heavy chain in association with a heterodimeric surrogate light chain. IGLL1 is one of the surrogate light chain subunits and is a member of the immunoglobulin geneuperfamily. Mutations in its gene can result in B cell deficiency and agammaglobulinemia, an autosomal recessive disease in which few or no gamma globulins or antibodies are made. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product