IGSF1 Blocking Peptide (33R-9971)
A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6152
Overview
Overview
| Synonyms | IGSF1 control peptide, IGSF1 antibody Blocking Peptide, Anti-IGSF1 Blocking Peptide, Immunoglobulin Superfamily Member 1 Blocking Peptide, IGCD1 Blocking Peptide, IGDC1 Blocking Peptide, INHBP Blocking Peptide, KIAA0364 Blocking Peptide, MGC75490 Blocking Peptide, PGSF2 Blocking Peptide, IGSF1, IGSF-1, IGSF 1, IGSF-1 Blocking Peptide, IGSF 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD |
|---|---|
| Molecular Weight | 149 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product