IGSF1 Blocking Peptide (33R-9971)

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF1 antibody, catalog no. 70R-6152

Synonyms IGSF1 control peptide, IGSF1 antibody Blocking Peptide, Anti-IGSF1 Blocking Peptide, Immunoglobulin Superfamily Member 1 Blocking Peptide, IGCD1 Blocking Peptide, IGDC1 Blocking Peptide, INHBP Blocking Peptide, KIAA0364 Blocking Peptide, MGC75490 Blocking Peptide, PGSF2 Blocking Peptide, IGSF1, IGSF-1, IGSF 1, IGSF-1 Blocking Peptide, IGSF 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD
Molecular Weight 149 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors