IGSF9 Blocking Peptide (33R-8693)

A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF9 antibody, catalog no. 70R-7213

Synonyms IGSF9 control peptide, IGSF9 antibody Blocking Peptide, Anti-IGSF9 Blocking Peptide, Immunoglobulin Superfamily Member 9 Blocking Peptide, FP18798 Blocking Peptide, IGSF9A Blocking Peptide, KIAA1355 Blocking Peptide, Nrt1 Blocking Peptide, IGSF9, IGSF-9, IGSF 9, IGSF-9 Blocking Peptide, IGSF 9 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA
Molecular Weight 125 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors