IGSF9 Blocking Peptide (33R-8693)
A synthetic peptide for use as a blocking control in assays to test for specificity of IGSF9 antibody, catalog no. 70R-7213
Overview
Overview
| Synonyms | IGSF9 control peptide, IGSF9 antibody Blocking Peptide, Anti-IGSF9 Blocking Peptide, Immunoglobulin Superfamily Member 9 Blocking Peptide, FP18798 Blocking Peptide, IGSF9A Blocking Peptide, KIAA1355 Blocking Peptide, Nrt1 Blocking Peptide, IGSF9, IGSF-9, IGSF 9, IGSF-9 Blocking Peptide, IGSF 9 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPRIDPDYVGRVRLQKGASLQIEGLRVEDQGWYECRVFFLDQHIPEDDFA |
|---|---|
| Molecular Weight | 125 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IGSF9 belongs to the immunoglobulin superfamily, turtle family. It contains 2 fibronectin type-III domains and 5 Ig-like (immunoglobulin-like) domains. It functions in dendrite outgrowth and synapse maturation. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product