IHH antibody (70R-1733)

Rabbit polyclonal IHH antibody

Synonyms Polyclonal IHH antibody, Anti-IHH antibody, HHG2 antibody, Indian Hedgehog Homolog antibody, BDA1 antibody
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen IHH antibody was raised using a synthetic peptide corresponding to a region with amino acids AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
Assay Information IHH Blocking Peptide, catalog no. 33R-1064, is also available for use as a blocking control in assays to test for specificity of this IHH antibody


Immunohistochemical staining using IHH antibody (70R-1733)

IHH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of IHH antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using IHH antibody (70R-1733) | IHH antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using IHH antibody (70R-1733) | IHH antibody (70R-1733) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors