IHH Blocking Peptide (33R-1064)
A synthetic peptide for use as a blocking control in assays to test for specificity of IHH antibody, catalog no. 70R-1733
Overview
Overview
| Synonyms | IHH control peptide, IHH antibody Blocking Peptide, Anti-IHH Blocking Peptide, Indian Hedgehog Homolog Blocking Peptide, BDA1 Blocking Peptide, HHG2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR |
|---|---|
| Molecular Weight | 45 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP). |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product