IHH Blocking Peptide (33R-1064)

A synthetic peptide for use as a blocking control in assays to test for specificity of IHH antibody, catalog no. 70R-1733

Synonyms IHH control peptide, IHH antibody Blocking Peptide, Anti-IHH Blocking Peptide, Indian Hedgehog Homolog Blocking Peptide, BDA1 Blocking Peptide, HHG2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
Molecular Weight 45 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors