IL1F5 Blocking Peptide (33R-4997)

A synthetic peptide for use as a blocking control in assays to test for specificity of IL1F5 antibody, catalog no. 70R-9339

Synonyms IL1F5 control peptide, IL1F5 antibody Blocking Peptide, Anti-IL1F5 Blocking Peptide, interleukin 1 family, member 5, delta Blocking Peptide, IL1F5 Blocking Peptide, IL1F5, ILF5-1, ILF5 1, ILF5-1 Blocking Peptide, ILF5 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED
Molecular Weight 17 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors