IL1F5 Blocking Peptide (33R-4997)
A synthetic peptide for use as a blocking control in assays to test for specificity of IL1F5 antibody, catalog no. 70R-9339
Overview
Overview
| Synonyms | IL1F5 control peptide, IL1F5 antibody Blocking Peptide, Anti-IL1F5 Blocking Peptide, interleukin 1 family, member 5, delta Blocking Peptide, IL1F5 Blocking Peptide, IL1F5, ILF5-1, ILF5 1, ILF5-1 Blocking Peptide, ILF5 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LGTKESKSFTFYRRDLGLTSSFESAAYPGWFLCTSPEADQPVRLTQISED |
|---|---|
| Molecular Weight | 17 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product