IL4 Blocking Peptide (33R-5062)
A synthetic peptide for use as a blocking control in assays to test for specificity of IL4 antibody, catalog no. 70R-6232
Overview
Overview
| Synonyms | IL4 control peptide, IL4 antibody Blocking Peptide, Anti-IL4 Blocking Peptide, Interleukin 4 Blocking Peptide, BSF1 Blocking Peptide, IL-4 Blocking Peptide, MGC79402 Blocking Peptide, IL4, IL-4, IL 4, IL-4 Blocking Peptide, IL 4 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
|---|---|
| Molecular Weight | 15 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product