IL4 Blocking Peptide (33R-5062)

A synthetic peptide for use as a blocking control in assays to test for specificity of IL4 antibody, catalog no. 70R-6232

Synonyms IL4 control peptide, IL4 antibody Blocking Peptide, Anti-IL4 Blocking Peptide, Interleukin 4 Blocking Peptide, BSF1 Blocking Peptide, IL-4 Blocking Peptide, MGC79402 Blocking Peptide, IL4, IL-4, IL 4, IL-4 Blocking Peptide, IL 4 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS
Molecular Weight 15 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IL4 is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors