ILDR1 Blocking Peptide (33R-8140)
A synthetic peptide for use as a blocking control in assays to test for specificity of ILDR1 antibody, catalog no. 70R-7528
Overview
Overview
| Synonyms | ILDR1 control peptide, ILDR1 antibody Blocking Peptide, Anti-ILDR1 Blocking Peptide, Immunoglobulin-Like Domain Containing Receptor 1 Blocking Peptide, ILDR1alpha Blocking Peptide, ILDR1beta Blocking Peptide, MGC50831 Blocking Peptide, ILDR1, ILDR-1, ILDR 1, ILDR-1 Blocking Peptide, ILDR 1 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV |
|---|---|
| Molecular Weight | 58 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | ILDR1 is a putative membrane receptor. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product