ILDR1 Blocking Peptide (33R-8140)

A synthetic peptide for use as a blocking control in assays to test for specificity of ILDR1 antibody, catalog no. 70R-7528

Synonyms ILDR1 control peptide, ILDR1 antibody Blocking Peptide, Anti-ILDR1 Blocking Peptide, Immunoglobulin-Like Domain Containing Receptor 1 Blocking Peptide, ILDR1alpha Blocking Peptide, ILDR1beta Blocking Peptide, MGC50831 Blocking Peptide, ILDR1, ILDR-1, ILDR 1, ILDR-1 Blocking Peptide, ILDR 1 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RRGSHSPHWPEEKPPSYRSLDITPGKNSRKKGSVERRSEKDSSHSGRSVV
Molecular Weight 58 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ILDR1 is a putative membrane receptor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors