IMPA2 antibody (70R-2599)

Rabbit polyclonal IMPA2 antibody raised against the middle region of IMPA2

Synonyms Polyclonal IMPA2 antibody, Anti-IMPA2 antibody, Inositol antibody, Myo-1 antibody, IMPA antibody
Specificity IMPA2 antibody was raised against the middle region of IMPA2
Cross Reactivity Human
Applications WB
Immunogen IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH
Assay Information IMPA2 Blocking Peptide, catalog no. 33R-7934, is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody


Western Blot analysis using IMPA2 antibody (70R-2599)

IMPA2 antibody (70R-2599) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of IMPA2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using IMPA2 antibody (70R-2599) | IMPA2 antibody (70R-2599) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors